PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10010865m
Common NameCARUB_v10010865mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 285aa    MW: 32871.9 Da    PI: 5.9187
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10010865mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.41.2e-112163148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd ll +++   G g+W++ a+  g     k+c++rw++yl
  Carubv10010865m 21 KGPWTLEEDTLLNNYISHNGEGRWNLLAKSSG-----KSCRLRWLNYL 63
                     79******************************.....*********97 PP

2Myb_DNA-binding52.41.2e-1669112146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Carubv10010865m  69 RGNLTPQEQLLILELHSKWGNR-WSKIAKYLP-GRTDNDIKNYWRT 112
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.2761663IPR017930Myb domain
SuperFamilySSF466897.11E-2719110IPR009057Homeodomain-like
SMARTSM007171.6E-82065IPR001005SANT/Myb domain
PfamPF002492.4E-92163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-172270IPR009057Homeodomain-like
CDDcd001674.95E-72363No hitNo description
PROSITE profilePS5129426.01564118IPR017930Myb domain
SMARTSM007172.6E-1568116IPR001005SANT/Myb domain
PfamPF002499.9E-1669112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2371117IPR009057Homeodomain-like
CDDcd001671.68E-1173112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MLNILKKRCN NGDEEGVEQR KGPWTLEEDT LLNNYISHNG EGRWNLLAKS SGKSCRLRWL  60
NYLKPDIKRG NLTPQEQLLI LELHSKWGNR WSKIAKYLPG RTDNDIKNYW RTRVQKQARQ  120
LNIDSNSHKF LEVVRSFWVP RLIHKMKDNS NTNSKATLPD LLGPVLQDSS FPHEFSNIDF  180
STSMSVDLKK TSQFMVMESS SDLETTCSLY LDGSRGSSSQ CVSEGYSSFP CLEEDYMVAT  240
MGSSDILQLQ DCHVADSTYE EDVTQDPMWN MDDIWQFKEY AHYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24211187108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00159DAPTransfer from AT1G25340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3348150.0AF334815.2 Arabidopsis thaliana putative transcription factor (MYB116) mRNA, complete cds.
GenBankAY5195580.0AY519558.1 Arabidopsis thaliana MYB transcription factor (At1g25340) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303509.10.0hypothetical protein CARUB_v10010865mg
SwissprotP813913e-56MYB05_ANTMA; Myb-related protein 305
TrEMBLR0GKF70.0R0GKF7_9BRAS; Uncharacterized protein
STRINGAT1G25340.11e-163(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.21e-169myb domain protein 116